PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_002865-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 362aa    MW: 41331.8 Da    PI: 6.0608
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_002865-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding506.8e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
    NNU_002865-RA 14 KGLWSPEEDEKLFNHITRFGIGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding47.25.3e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +++eE++ ++ +++ lG++ W+ Ia+ ++ gRt++++k++w++
    NNU_002865-RA  67 RGMFSQEEEDAIISLHEALGNR-WAQIAAQLP-GRTDNEIKNFWNS 110
                      788*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-25664IPR009057Homeodomain-like
PROSITE profilePS5129416.683961IPR017930Myb domain
SuperFamilySSF466899.36E-2911108IPR009057Homeodomain-like
SMARTSM007172.7E-111363IPR001005SANT/Myb domain
PfamPF002494.6E-131461IPR001005SANT/Myb domain
CDDcd001676.20E-101761No hitNo description
PROSITE profilePS5129424.62162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-2665117IPR009057Homeodomain-like
SMARTSM007177.5E-1466114IPR001005SANT/Myb domain
PfamPF002496.5E-1467111IPR001005SANT/Myb domain
CDDcd001674.31E-1070109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MGRHSCCFKQ KLKKGLWSPE EDEKLFNHIT RFGIGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGMF SQEEEDAIIS LHEALGNRWA QIAAQLPGRT DNEIKNFWNS CLKKKLKQQG  120
IDPNTHKPLC EAELRDDKKS REEDSLQPSQ PKRPRRTQSS EEFGQAFSVN SSGYHVAGLD  180
GTSEEKFLTK QIFDPFPLFE FQTGINPVGT NSNLVSQHHQ NFRPFNQAHL ATTFDFGFTS  240
MPQLTSVTET DTSENNSTSR VSSLFYNETK ESSSNSCNMS SQAEFQMNNM VSNASFCWDS  300
SDTRLEPVFQ FQFNGIKSEE LELRSWQDEQ KQTQSSDDFS SFPLTSLSED LTGAGFDMFQ  360
HI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010248622.10.0PREDICTED: myb-related protein Hv33-like
TrEMBLA0A061FTT71e-152A0A061FTT7_THECC; Myb domain protein 86
STRINGPOPTR_0015s09430.11e-148(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-82myb domain protein 86